Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATCCTCCGATCCCACTTCCGACCCAACCTCTGACCCCACCACAACTCCAGAAAACGGCACAACCCCAATCAAAGTTGCCTTAATCACCGGAATCACAGGCCAAGACGGGTCCTACCTCACCGAATTCCTCCTCTCAAAGGGCTATTCCGTCCATGGCTTAATCAGACGGTCCTCAAACTTCAACACACAAAGAATCAACCACATCTACATCGACCCACACAACGCCCATAAAGCCCGTATGAAGCTCCACTACGCCGATCTCACCGACGCCTCCTCTCTCCGCCGTTGGATCGACATTATCTCTCCTGATGAAGTCTACAACCTGGCCGCACAATCCCATGTCGCTGTTTCCTTTGAGATCCCTGATTACACGGCGGATGTTGTTGCCACGGGTTCACTGCGG ATGGCATCCTCCGATCCCACTTCCGACCCAACCTCTGACCCCACCACAACTCCAGAAAACGGCACAACCCCAATCAAAGTTGCCTTAATCACCGGAATCACAGGCCAAGACGGGTCCTACCTCACCGAATTCCTCCTCTCAAAGGGCTATTCCGTCCATGGCTTAATCAGACGGTCCTCAAACTTCAACACACAAAGAATCAACCACATCTACATCGACCCACACAACGCCCATAAAGCCCGTATGAAGCTCCACTACGCCGATCTCACCGACGCCTCCTCTCTCCGCCGTTGGATCGACATTATCTCTCCTGATGAAGTCTACAACCTGGCCGCACAATCCCATGTCGCTGTTTCCTTTGAGATCCCTGATTACACGGCGGATGTTGTTGCCACGGGTTCACTGCGG ATGGCATCCTCCGATCCCACTTCCGACCCAACCTCTGACCCCACCACAACTCCAGAAAACGGCACAACCCCAATCAAAGTTGCCTTAATCACCGGAATCACAGGCCAAGACGGGTCCTACCTCACCGAATTCCTCCTCTCAAAGGGCTATTCCGTCCATGGCTTAATCAGACGGTCCTCAAACTTCAACACACAAAGAATCAACCACATCTACATCGACCCACACAACGCCCATAAAGCCCGTATGAAGCTCCACTACGCCGATCTCACCGACGCCTCCTCTCTCCGCCGTTGGATCGACATTATCTCTCCTGATGAAGTCTACAACCTGGCCGCACAATCCCATGTCGCTGTTTCCTTTGAGATCCCTGATTACACGGCGGATGTTGTTGCCACGGGTTCACTGCGG MASSDPTSDPTSDPTTTPENGTTPIKVALITGITGQDGSYLTEFLLSKGYSVHGLIRRSSNFNTQRINHIYIDPHNAHKARMKLHYADLTDASSLRRWIDIISPDEVYNLAAQSHVAVSFEIPDYTADVVATGSLR Relationships
The following mRNA feature(s) are a part of this gene:
Homology
BLAST of Spo19121.1 vs. NCBI nr
Match: gi|902217290|gb|KNA17656.1| (hypothetical protein SOVF_077970 [Spinacia oleracea]) HSP 1 Score: 269.6 bits (688), Expect = 2.900e-69 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 1
BLAST of Spo19121.1 vs. NCBI nr
Match: gi|743839402|ref|XP_011025933.1| (PREDICTED: GDP-mannose 4,6 dehydratase 1 [Populus euphratica]) HSP 1 Score: 221.9 bits (564), Expect = 7.000e-55 Identity = 111/129 (86.05%), Postives = 116/129 (89.92%), Query Frame = 1
BLAST of Spo19121.1 vs. NCBI nr
Match: gi|729300054|ref|XP_010557675.1| (PREDICTED: GDP-mannose 4,6 dehydratase 2 [Tarenaya hassleriana]) HSP 1 Score: 220.3 bits (560), Expect = 2.000e-54 Identity = 110/129 (85.27%), Postives = 115/129 (89.15%), Query Frame = 1
BLAST of Spo19121.1 vs. NCBI nr
Match: gi|224097148|ref|XP_002310852.1| (GDP-mannose 4 family protein [Populus trichocarpa]) HSP 1 Score: 218.0 bits (554), Expect = 1.000e-53 Identity = 110/130 (84.62%), Postives = 119/130 (91.54%), Query Frame = 1
BLAST of Spo19121.1 vs. NCBI nr
Match: gi|595818568|ref|XP_007204374.1| (hypothetical protein PRUPE_ppa007357mg [Prunus persica]) HSP 1 Score: 216.9 bits (551), Expect = 2.300e-53 Identity = 112/136 (82.35%), Postives = 119/136 (87.50%), Query Frame = 1
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RDQ4_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_077970 PE=3 SV=1) HSP 1 Score: 269.6 bits (688), Expect = 2.000e-69 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 1
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Match: A9PEZ8_POPTR (GDP-mannose 4 family protein OS=Populus trichocarpa GN=POPTR_0007s13960g PE=2 SV=1) HSP 1 Score: 218.0 bits (554), Expect = 7.000e-54 Identity = 110/130 (84.62%), Postives = 119/130 (91.54%), Query Frame = 1
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Match: M5W8I7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa007357mg PE=3 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 1.600e-53 Identity = 112/136 (82.35%), Postives = 119/136 (87.50%), Query Frame = 1
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Match: A0A0D2QVZ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G196100 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 3.500e-53 Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = 1
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Match: A0A103XKB6_CYNCS (Uncharacterized protein OS=Cynara cardunculus var. scolymus GN=Ccrd_005653 PE=3 SV=1) HSP 1 Score: 215.3 bits (547), Expect = 4.600e-53 Identity = 109/122 (89.34%), Postives = 110/122 (90.16%), Query Frame = 1
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Match: GMD2_ARATH (GDP-mannose 4,6 dehydratase 2 OS=Arabidopsis thaliana GN=MUR1 PE=1 SV=3) HSP 1 Score: 212.2 bits (539), Expect = 3.500e-54 Identity = 111/139 (79.86%), Postives = 119/139 (85.61%), Query Frame = 1
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Match: GMD1_ARATH (GDP-mannose 4,6 dehydratase 1 OS=Arabidopsis thaliana GN=GMD1 PE=1 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 1.500e-52 Identity = 97/113 (85.84%), Postives = 106/113 (93.81%), Query Frame = 1
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Match: GM4D_VIBCH (GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 6.600e-37 Identity = 77/111 (69.37%), Postives = 88/111 (79.28%), Query Frame = 1
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Match: GM4D_VIBCL (GDP-mannose 4,6-dehydratase OS=Vibrio cholerae GN=gmd PE=3 SV=2) HSP 1 Score: 153.7 bits (387), Expect = 1.500e-36 Identity = 76/111 (68.47%), Postives = 89/111 (80.18%), Query Frame = 1
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Match: GM4D_YERE8 (GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2) HSP 1 Score: 152.1 bits (383), Expect = 4.300e-36 Identity = 77/112 (68.75%), Postives = 87/112 (77.68%), Query Frame = 1
BLAST of Spo19121.1 vs. TAIR (Arabidopsis)
Match: AT3G51160.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 212.2 bits (539), Expect = 2.000e-55 Identity = 111/139 (79.86%), Postives = 119/139 (85.61%), Query Frame = 1
BLAST of Spo19121.1 vs. TAIR (Arabidopsis)
Match: AT5G66280.1 (GDP-D-mannose 4,6-dehydratase 1) HSP 1 Score: 206.8 bits (525), Expect = 8.200e-54 Identity = 97/113 (85.84%), Postives = 106/113 (93.81%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo19121.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo19121.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo19121.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo19121.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 2
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
RNA-Seq Expression
|