Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTCAGAAGCTGCACGCACTGCGCGAGACTCTTTAGAATTGGCATTTCAAATGTCAAACATACTTGATACAGGAGTAGATCGCCACACTCTCTCTGTCCTAATCGCATTATGTGATCTTGGCTTAAACCCTGAAGCGCTTGCCGCTGTTGTCAAGGAGCTTAGAACAGACCCCTCACTTCCTTCAACCATTCCACCTGATTCCTGA ATGGATTCAGAAGCTGCACGCACTGCGCGAGACTCTTTAGAATTGGCATTTCAAATGTCAAACATACTTGATACAGGAGTAGATCGCCACACTCTCTCTGTCCTAATCGCATTATGTGATCTTGGCTTAAACCCTGAAGCGCTTGCCGCTGTTGTCAAGGAGCTTAGAACAGACCCCTCACTTCCTTCAACCATTCCACCTGATTCCTGA ATGGATTCAGAAGCTGCACGCACTGCGCGAGACTCTTTAGAATTGGCATTTCAAATGTCAAACATACTTGATACAGGAGTAGATCGCCACACTCTCTCTGTCCTAATCGCATTATGTGATCTTGGCTTAAACCCTGAAGCGCTTGCCGCTGTTGTCAAGGAGCTTAGAACAGACCCCTCACTTCCTTCAACCATTCCACCTGATTCCTGA MDSEAARTARDSLELAFQMSNILDTGVDRHTLSVLIALCDLGLNPEALAAVVKELRTDPSLPSTIPPDS Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of Spo24307.1 vs. NCBI nr
Match: gi|902048919|gb|KNA02850.1| (hypothetical protein SOVF_214750 [Spinacia oleracea]) HSP 1 Score: 133.7 bits (335), Expect = 1.300e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Spo24307.1 vs. NCBI nr
Match: gi|731324600|ref|XP_010673057.1| (PREDICTED: mitotic-spindle organizing protein 1B-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 118.6 bits (296), Expect = 4.200e-24 Identity = 62/69 (89.86%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Spo24307.1 vs. NCBI nr
Match: gi|1000941381|ref|XP_015582673.1| (PREDICTED: mitotic-spindle organizing protein 1A [Ricinus communis]) HSP 1 Score: 105.1 bits (261), Expect = 4.800e-20 Identity = 54/66 (81.82%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Spo24307.1 vs. NCBI nr
Match: gi|920689027|gb|KOM33010.1| (hypothetical protein LR48_Vigan01g256600 [Vigna angularis]) HSP 1 Score: 104.8 bits (260), Expect = 6.300e-20 Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Spo24307.1 vs. NCBI nr
Match: gi|356504256|ref|XP_003520913.1| (PREDICTED: mitotic-spindle organizing protein 1B [Glycine max]) HSP 1 Score: 104.8 bits (260), Expect = 6.300e-20 Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Match: A0A0K9Q6X9_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_214750 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 8.900e-29 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Match: A0A0J8FH33_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g063220 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 2.900e-24 Identity = 62/69 (89.86%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Match: B9T1I8_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0186670 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.400e-20 Identity = 54/66 (81.82%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Match: A0A0B2PDD0_GLYSO (Mitotic-spindle organizing protein 1B OS=Glycine soja GN=glysoja_038443 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.400e-20 Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Match: C6T5S8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_03G068900 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.400e-20 Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Match: MZT1B_ARATH (Mitotic-spindle organizing protein 1B OS=Arabidopsis thaliana GN=GIP1 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.200e-20 Identity = 50/65 (76.92%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Match: MZT1A_ARATH (Mitotic-spindle organizing protein 1A OS=Arabidopsis thaliana GN=GIP2 PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.100e-19 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 1
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Match: MZT1_PICSI (Mitotic-spindle organizing protein 1 OS=Picea sitchensis PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.200e-16 Identity = 41/58 (70.69%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Match: MZT1_TAEGU (Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata GN=mzt1 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.500e-8 Identity = 28/58 (48.28%), Postives = 44/58 (75.86%), Query Frame = 1
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Match: MZT1_MOUSE (Mitotic-spindle organizing protein 1 OS=Mus musculus GN=Mzt1 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.500e-8 Identity = 23/47 (48.94%), Postives = 39/47 (82.98%), Query Frame = 1
BLAST of Spo24307.1 vs. TAIR (Arabidopsis)
Match: AT4G09550.1 (AtGCP3 interacting protein 1) HSP 1 Score: 99.0 bits (245), Expect = 1.200e-21 Identity = 50/65 (76.92%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Spo24307.1 vs. TAIR (Arabidopsis)
Match: AT1G73790.1 (Protein of unknown function (DUF3743)) HSP 1 Score: 94.7 bits (234), Expect = 2.300e-20 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo24307.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo24307.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo24307.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo24307.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 2
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|