

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAGCCGCCACTTTCTCCTCCTTGCCCTCTCTCTCCTCGCTGTAGTCTCCGCCGTATCCGCGTCCAGGAAACACGGCGGCGCACTCGTCGGAGGATACTCGCCGATCAAGGACGTCTCCGATCCGTACGTTCAAGGCGTCGGGCAATTCGCGGTTACCGAATACAACAAAGATCAAAAGGCTCACCTGAAATTTGTGAAGGTGGTGAAAGGTGAGTCACAGGTTGTCTCCGGGACGAATTACCGTCTTTTTATCGAGGCCGATGATAATAGCCAGTACGTCGCTATTGTCTATGATGTGCCGTGGCGACATCAGAGGAGTCTAACCTCATTTACACCTGCTGCTTAGATGTCGAGCCGCCACTTTCTCCTCCTTGCCCTCTCTCTCCTCGCTGTAGTCTCCGCCGTATCCGCGTCCAGGAAACACGGCGGCGCACTCGTCGGAGGATACTCGCCGATCAAGGACGTCTCCGATCCGTACGTTCAAGGCGTCGGGCAATTCGCGGTTACCGAATACAACAAAGATCAAAAGGCTCACCTGAAATTTGTGAAGGTGGTGAAAGGTGAGTCACAGGTTGTCTCCGGGACGAATTACCGTCTTTTTATCGAGGCCGATGATAATAGCCAGTACGTCGCTATTGTCTATGATGTGCCGTGGCGACATCAGAGGAGTCTAACCTCATTTACACCTGCTGCTTAG ATGTCGAGCCGCCACTTTCTCCTCCTTGCCCTCTCTCTCCTCGCTGTAGTCTCCGCCGTATCCGCGTCCAGGAAACACGGCGGCGCACTCGTCGGAGGATACTCGCCGATCAAGGACGTCTCCGATCCGTACGTTCAAGGCGTCGGGCAATTCGCGGTTACCGAATACAACAAAGATCAAAAGGCTCACCTGAAATTTGTGAAGGTGGTGAAAGGTGAGTCACAGGTTGTCTCCGGGACGAATTACCGTCTTTTTATCGAGGCCGATGATAATAGCCAGTACGTCGCTATTGTCTATGATGTGCCGTGGCGACATCAGAGGAGTCTAACCTCATTTACACCTGCTGCTTAG MSSRHFLLLALSLLAVVSAVSASRKHGGALVGGYSPIKDVSDPYVQGVGQFAVTEYNKDQKAHLKFVKVVKGESQVVSGTNYRLFIEADDNSQYVAIVYDVPWRHQRSLTSFTPAA Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of Spo20170.1 vs. NCBI nr
Match: gi|902233059|gb|KNA22917.1| (hypothetical protein SOVF_029630 [Spinacia oleracea]) HSP 1 Score: 228.4 bits (581), Expect = 6.400e-57 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Spo20170.1 vs. NCBI nr
Match: gi|731350829|ref|XP_010686713.1| (PREDICTED: cysteine proteinase inhibitor 1 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 149.1 bits (375), Expect = 4.900e-33 Identity = 74/112 (66.07%), Postives = 92/112 (82.14%), Query Frame = 1
BLAST of Spo20170.1 vs. NCBI nr
Match: gi|703092669|ref|XP_010094696.1| (Cysteine proteinase inhibitor 5 [Morus notabilis]) HSP 1 Score: 117.1 bits (292), Expect = 2.100e-23 Identity = 61/115 (53.04%), Postives = 82/115 (71.30%), Query Frame = 1
BLAST of Spo20170.1 vs. NCBI nr
Match: gi|746657137|gb|AJD79055.1| (CPI-4 [Morus alba var. atropurpurea]) HSP 1 Score: 116.7 bits (291), Expect = 2.700e-23 Identity = 61/115 (53.04%), Postives = 82/115 (71.30%), Query Frame = 1
BLAST of Spo20170.1 vs. NCBI nr
Match: gi|388496176|gb|AFK36154.1| (unknown [Lotus japonicus]) HSP 1 Score: 112.5 bits (280), Expect = 5.100e-22 Identity = 58/114 (50.88%), Postives = 80/114 (70.18%), Query Frame = 1
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Match: A0A0K9RVP8_SPIOL (Cysteine proteinase inhibitor OS=Spinacia oleracea GN=SOVF_029630 PE=3 SV=1) HSP 1 Score: 228.4 bits (581), Expect = 4.400e-57 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Match: A0A0J8EMH9_BETVU (Cysteine proteinase inhibitor OS=Beta vulgaris subsp. vulgaris GN=BVRB_8g184860 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.400e-33 Identity = 74/112 (66.07%), Postives = 92/112 (82.14%), Query Frame = 1
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Match: W9R7F6_9ROSA (Cysteine proteinase inhibitor OS=Morus notabilis GN=L484_004273 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.400e-23 Identity = 61/115 (53.04%), Postives = 82/115 (71.30%), Query Frame = 1
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Match: A0A0B4ZWL9_MORAL (Cysteine proteinase inhibitor OS=Morus alba var. atropurpurea PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.900e-23 Identity = 61/115 (53.04%), Postives = 82/115 (71.30%), Query Frame = 1
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Match: I3S7B2_LOTJA (Cysteine proteinase inhibitor OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.600e-22 Identity = 58/114 (50.88%), Postives = 80/114 (70.18%), Query Frame = 1
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 107.8 bits (268), Expect = 7.900e-23 Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 1
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.400e-19 Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 1
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.800e-17 Identity = 52/108 (48.15%), Postives = 69/108 (63.89%), Query Frame = 1
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 9.300e-16 Identity = 52/116 (44.83%), Postives = 68/116 (58.62%), Query Frame = 1
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.600e-13 Identity = 46/106 (43.40%), Postives = 62/106 (58.49%), Query Frame = 1
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 107.8 bits (268), Expect = 4.400e-24 Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 1
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 84.3 bits (207), Expect = 5.200e-17 Identity = 52/116 (44.83%), Postives = 68/116 (58.62%), Query Frame = 1
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 57.8 bits (138), Expect = 5.300e-9 Identity = 38/115 (33.04%), Postives = 63/115 (54.78%), Query Frame = 1
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 54.3 bits (129), Expect = 5.800e-8 Identity = 30/92 (32.61%), Postives = 53/92 (57.61%), Query Frame = 1
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 53.1 bits (126), Expect = 1.300e-7 Identity = 36/120 (30.00%), Postives = 62/120 (51.67%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo20170.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo20170.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo20170.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo20170.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 5
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|