

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGTAGTTGTACCCTTAACTCATGCTCCTCACTTCATCAAGCATTTGACCTTGATGAAGCTCTAAATACACAACCTACACCATCGAATATCATCTCCATTGATCACGTCGTCATGGTGGCACCAAAACATTCTTCCCCGGTAACACGGGTGGCCGATTTGCCTACGGTTACCGCCAGGATCAATGCCATTTGCTCGGTATGTATGGAAGGTTACCGACGGCTGGCTAAGCGAATGCCATGTGGACACGTGTTCCATGCTACTTGTATTGCCCCTTGGCTATCTATTAGTAATTCTTGCCCGCTTTGCCGTACTCTTGTCCTTGATAGTTAAATGATGAGTAGTTGTACCCTTAACTCATGCTCCTCACTTCATCAAGCATTTGACCTTGATGAAGCTCTAAATACACAACCTACACCATCGAATATCATCTCCATTGATCACGTCGTCATGGTGGCACCAAAACATTCTTCCCCGGTAACACGGGTGGCCGATTTGCCTACGGTTACCGCCAGGATCAATGCCATTTGCTCGGTATGTATGGAAGGTTACCGACGGCTGGCTAAGCGAATGCCATGTGGACACGTGTTCCATGCTACTTGTATTGCCCCTTGGCTATCTATTAGTAATTCTTGCCCGCTTTGCCGTACTCTTGTCCTTGATAGTTAA ATGATGAGTAGTTGTACCCTTAACTCATGCTCCTCACTTCATCAAGCATTTGACCTTGATGAAGCTCTAAATACACAACCTACACCATCGAATATCATCTCCATTGATCACGTCGTCATGGTGGCACCAAAACATTCTTCCCCGGTAACACGGGTGGCCGATTTGCCTACGGTTACCGCCAGGATCAATGCCATTTGCTCGGTATGTATGGAAGGTTACCGACGGCTGGCTAAGCGAATGCCATGTGGACACGTGTTCCATGCTACTTGTATTGCCCCTTGGCTATCTATTAGTAATTCTTGCCCGCTTTGCCGTACTCTTGTCCTTGATAGTTAA MMSSCTLNSCSSLHQAFDLDEALNTQPTPSNIISIDHVVMVAPKHSSPVTRVADLPTVTARINAICSVCMEGYRRLAKRMPCGHVFHATCIAPWLSISNSCPLCRTLVLDS Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of Spo11258.1 vs. NCBI nr
Match: gi|902153249|gb|KNA05681.1| (hypothetical protein SOVF_188010 [Spinacia oleracea]) HSP 1 Score: 229.6 bits (584), Expect = 2.700e-57 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
BLAST of Spo11258.1 vs. NCBI nr
Match: gi|870851127|gb|KMT03193.1| (hypothetical protein BVRB_8g197420 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 127.1 bits (318), Expect = 1.900e-26 Identity = 69/105 (65.71%), Postives = 77/105 (73.33%), Query Frame = 1
BLAST of Spo11258.1 vs. NCBI nr
Match: gi|470105025|ref|XP_004288889.1| (PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 85.9 bits (211), Expect = 4.900e-14 Identity = 50/110 (45.45%), Postives = 62/110 (56.36%), Query Frame = 1
BLAST of Spo11258.1 vs. NCBI nr
Match: gi|658005059|ref|XP_008337662.1| (PREDICTED: E3 ubiquitin-protein ligase ATL59-like [Malus domestica]) HSP 1 Score: 80.1 bits (196), Expect = 2.700e-12 Identity = 44/120 (36.67%), Postives = 69/120 (57.50%), Query Frame = 1
BLAST of Spo11258.1 vs. NCBI nr
Match: gi|694323234|ref|XP_009352695.1| (PREDICTED: E3 ubiquitin-protein ligase ATL59-like [Pyrus x bretschneideri]) HSP 1 Score: 79.7 bits (195), Expect = 3.500e-12 Identity = 44/114 (38.60%), Postives = 67/114 (58.77%), Query Frame = 1
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QGJ9_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_188010 PE=4 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 1.900e-57 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Match: A0A0J8BTG3_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_8g197420 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.300e-26 Identity = 69/105 (65.71%), Postives = 77/105 (73.33%), Query Frame = 1
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QEJ2_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_188000 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.200e-12 Identity = 41/104 (39.42%), Postives = 58/104 (55.77%), Query Frame = 1
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Match: A0A067KCF7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_07378 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.400e-12 Identity = 43/104 (41.35%), Postives = 59/104 (56.73%), Query Frame = 1
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Match: B9RKI4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1049910 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 7.100e-12 Identity = 45/107 (42.06%), Postives = 64/107 (59.81%), Query Frame = 1
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Match: RDUF1_ARATH (E3 ubiquitin-protein ligase RDUF1 OS=Arabidopsis thaliana GN=RDUF1 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.800e-8 Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Match: RHC2A_ARATH (Probable E3 ubiquitin-protein ligase RHC2A OS=Arabidopsis thaliana GN=RHC2A PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.300e-8 Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 1
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Match: RN115_MOUSE (E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.000e-8 Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Match: RN115_HUMAN (E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 5.200e-8 Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Match: RDUF2_ARATH (E3 ubiquitin-protein ligase RDUF2 OS=Arabidopsis thaliana GN=DURF2 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 6.800e-8 Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 1
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Match: AT4G26400.2 (RING/U-box superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 4.600e-10 Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 1
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Match: AT5G56340.1 (RING/U-box superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 5.900e-10 Identity = 27/56 (48.21%), Postives = 34/56 (60.71%), Query Frame = 1
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Match: AT3G60080.1 (RING/U-box superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 1.000e-9 Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 1
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Match: AT3G46620.1 (zinc finger (C3HC4-type RING finger) family protein) HSP 1 Score: 60.1 bits (144), Expect = 1.000e-9 Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Match: AT2G39720.1 (RING-H2 finger C2A) HSP 1 Score: 59.7 bits (143), Expect = 1.300e-9 Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo11258.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo11258.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo11258.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo11258.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 5
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|