

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGCAATGTGGCTACCCTTACCCTACTCGCGGTGGTTGTGGTGGCAACGCTACTAGCCACGACACCAACGACAGAGGCGGTGACATGTAGTCCGGTGCAGCTAAGCCCTTGTGCACCAGCAATCATGTCCAACAAAGCACCAACAAAGGCATGTTGTGATAAATTAAAGGAGCAGAAACCTTGCCTTTGTGGATATTCCAAGAACCCAACTCTTAAGCCTTATGTTAACTCCCCTGGTGCTAAACGTGTGGCTTCCACTTGTAAAGTCAGCGTTAGTTGCTAAATGGCTAGCAATGTGGCTACCCTTACCCTACTCGCGGTGGTTGTGGTGGCAACGCTACTAGCCACGACACCAACGACAGAGGCGGTGACATGTAGTCCGGTGCAGCTAAGCCCTTGTGCACCAGCAATCATGTCCAACAAAGCACCAACAAAGGCATGTTGTGATAAATTAAAGGAGCAGAAACCTTGCCTTTGTGGATATTCCAAGAACCCAACTCTTAAGCCTTATGTTAACTCCCCTGGTGCTAAACGTGTGGCTTCCACTTGTAAAGTCAGCGTTAGTTGCTAA ATGGCTAGCAATGTGGCTACCCTTACCCTACTCGCGGTGGTTGTGGTGGCAACGCTACTAGCCACGACACCAACGACAGAGGCGGTGACATGTAGTCCGGTGCAGCTAAGCCCTTGTGCACCAGCAATCATGTCCAACAAAGCACCAACAAAGGCATGTTGTGATAAATTAAAGGAGCAGAAACCTTGCCTTTGTGGATATTCCAAGAACCCAACTCTTAAGCCTTATGTTAACTCCCCTGGTGCTAAACGTGTGGCTTCCACTTGTAAAGTCAGCGTTAGTTGCTAA MASNVATLTLLAVVVVATLLATTPTTEAVTCSPVQLSPCAPAIMSNKAPTKACCDKLKEQKPCLCGYSKNPTLKPYVNSPGAKRVASTCKVSVSC Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of Spo00220.1 vs. NCBI nr
Match: gi|902168520|gb|KNA07509.1| (hypothetical protein SOVF_171170 [Spinacia oleracea]) HSP 1 Score: 181.4 bits (459), Expect = 7.300e-43 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Spo00220.1 vs. NCBI nr
Match: gi|870867726|gb|KMT18595.1| (hypothetical protein BVRB_2g027260 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 152.5 bits (384), Expect = 3.600e-34 Identity = 79/93 (84.95%), Postives = 84/93 (90.32%), Query Frame = 1
BLAST of Spo00220.1 vs. NCBI nr
Match: gi|902168519|gb|KNA07508.1| (hypothetical protein SOVF_171160 [Spinacia oleracea]) HSP 1 Score: 144.4 bits (363), Expect = 9.900e-32 Identity = 72/95 (75.79%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Spo00220.1 vs. NCBI nr
Match: gi|870867723|gb|KMT18592.1| (hypothetical protein BVRB_2g027230 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 139.4 bits (350), Expect = 3.200e-30 Identity = 72/95 (75.79%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Spo00220.1 vs. NCBI nr
Match: gi|870867724|gb|KMT18593.1| (hypothetical protein BVRB_2g027240 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 138.7 bits (348), Expect = 5.400e-30 Identity = 69/95 (72.63%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QJS7_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_171170 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 5.100e-43 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CXY7_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_2g027260 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.500e-34 Identity = 79/93 (84.95%), Postives = 84/93 (90.32%), Query Frame = 1
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QLE4_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_171160 PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 6.900e-32 Identity = 72/95 (75.79%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Match: A0A0J8CYA9_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_2g027230 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.200e-30 Identity = 72/95 (75.79%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Match: A0A0J8D325_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_2g027240 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.800e-30 Identity = 69/95 (72.63%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Match: NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum PE=1 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.100e-19 Identity = 44/66 (66.67%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.100e-18 Identity = 49/82 (59.76%), Postives = 56/82 (68.29%), Query Frame = 1
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.000e-16 Identity = 40/65 (61.54%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Match: NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.000e-8 Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 1
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Match: NLTP2_MAIZE (Probable non-specific lipid-transfer protein 2 OS=Zea mays PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.600e-8 Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 1
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 96.3 bits (238), Expect = 1.100e-20 Identity = 46/83 (55.42%), Postives = 64/83 (77.11%), Query Frame = 1
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 91.3 bits (225), Expect = 3.500e-19 Identity = 43/87 (49.43%), Postives = 62/87 (71.26%), Query Frame = 1
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Match: AT5G38195.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 4.200e-12 Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Match: AT1G73780.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 4.200e-12 Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 9.300e-12 Identity = 31/63 (49.21%), Postives = 39/63 (61.90%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo00220.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo00220.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo00220.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo00220.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 5
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
|