Spo27285 (gene)

Overview
NameSpo27285
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr5 : 8654939 .. 8655539 (+)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGTCGCTATTTCTCTCCTCCCCATCTGACCGCAGCGCCGCCCAGCCCTCACCGAGTGTACAAGGTCACCGACTTACCGACAACCACAGGCGAAAGCTCCGGCCCACAGGTCCACCACCGTCAGTTTTCCGTCACCGCGCGCCCACGACGAGAAGCTGAAGCTCCGCCCCTCACCGTTCACCAACTCCGTCGCCGAGTCGCCGTACTACTCTACAGGGAGACGAGCGGTTCAGGTACGTTTTTATTGGTTTTAAATTTGAATTTGAATTTGTTGTTCATGATTAATTGTGTGCTTAGACTAGTTTACCTGTTTTTATTGATTAGTTGTGATCAAAATTGTCTGGTATACTTTAGTTAATTGCTTAATTGATTCTTAAGTTTGTGTTTATGAACAAGGTCTGTGTGTGATTGCTGCTGAATTTTCTCTTGCTTCACAGAATATAAGTTTTGTATAATTTTCATGGAAAATAATTAAATTTTGGTATTTTCATACTTAATTTTTACAAGCATATATTAGCTAAGAACAGTCGAAGATGCATCAGGCAGAAATAATACTTTGAACAATAGTAAACCTGAGGGAAAGAGGTTATCACGAATCTAA

mRNA sequence

ATGTCGCTATTTCTCTCCTCCCCATCTGACCGCAGCGCCGCCCAGCCCTCACCGAGTGCGAAAGCTCCGGCCCACAGGTCCACCACCGTCAGTTTTCCGTCACCGCGCGCCCACGACGAGAAGCTGAAGCTCCGCCCCTCACCGTTCACCAACTCCGTCGCCGAGTCGCCGTACTACTCTACAGGGAGACGAGCGGTTCAGCTAAGAACAGTCGAAGATGCATCAGGCAGAAATAATACTTTGAACAATAGTAAACCTGAGGGAAAGAGGTTATCACGAATCTAA

Coding sequence (CDS)

ATGTCGCTATTTCTCTCCTCCCCATCTGACCGCAGCGCCGCCCAGCCCTCACCGAGTGCGAAAGCTCCGGCCCACAGGTCCACCACCGTCAGTTTTCCGTCACCGCGCGCCCACGACGAGAAGCTGAAGCTCCGCCCCTCACCGTTCACCAACTCCGTCGCCGAGTCGCCGTACTACTCTACAGGGAGACGAGCGGTTCAGCTAAGAACAGTCGAAGATGCATCAGGCAGAAATAATACTTTGAACAATAGTAAACCTGAGGGAAAGAGGTTATCACGAATCTAA

Protein sequence

MSLFLSSPSDRSAAQPSPSAKAPAHRSTTVSFPSPRAHDEKLKLRPSPFTNSVAESPYYSTGRRAVQLRTVEDASGRNNTLNNSKPEGKRLSRI
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo27285.1Spo27285.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo27285.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo27285.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo27285.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo27285.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0030003 cellular cation homeostasis
biological_process GO:0009737 response to abscisic acid
biological_process GO:0016226 iron-sulfur cluster assembly
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0006974 cellular response to DNA damage stimulus
biological_process GO:0042742 defense response to bacterium
biological_process GO:0000023 maltose metabolic process
biological_process GO:0043085 positive regulation of catalytic activity
biological_process GO:0046777 protein autophosphorylation
biological_process GO:0010155 regulation of proton transport
biological_process GO:0009637 response to blue light
biological_process GO:0019252 starch biosynthetic process
biological_process GO:0009228 thiamine biosynthetic process
biological_process GO:0052837 thiazole biosynthetic process
biological_process GO:0006508 proteolysis
biological_process GO:0009414 response to water deprivation
biological_process GO:0034765 regulation of ion transmembrane transport
biological_process GO:0009627 systemic acquired resistance
biological_process GO:0051604 protein maturation
biological_process GO:0009805 coumarin biosynthetic process
biological_process GO:0009809 lignin biosynthetic process
biological_process GO:0032259 methylation
biological_process GO:0009811 stilbene biosynthetic process
biological_process GO:0006121 mitochondrial electron transport, succinate to ubiquinone
biological_process GO:0006099 tricarboxylic acid cycle
biological_process GO:0042744 hydrogen peroxide catabolic process
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0006662 glycerol ether metabolic process
biological_process GO:0006950 response to stress
biological_process GO:0009415 response to water
biological_process GO:0008152 metabolic process
biological_process GO:0006534 cysteine metabolic process
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0016558 protein import into peroxisome matrix
biological_process GO:0042550 photosystem I stabilization
biological_process GO:0016573 histone acetylation
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0071806 protein transmembrane transport
biological_process GO:0006626 protein targeting to mitochondrion
biological_process GO:0000165 MAPK cascade
biological_process GO:0006464 cellular protein modification process
biological_process GO:0050821 protein stabilization
biological_process GO:0006468 protein phosphorylation
biological_process GO:0006635 fatty acid beta-oxidation
biological_process GO:0070838 divalent metal ion transport
biological_process GO:0009780 photosynthetic NADP+ reduction
biological_process GO:0015031 protein transport
biological_process GO:0009773 photosynthetic electron transport in photosystem I
biological_process GO:0009069 serine family amino acid metabolic process
cellular_component GO:0005742 mitochondrial outer membrane translocase complex
cellular_component GO:0005829 cytosol
cellular_component GO:0010319 stromule
cellular_component GO:0009579 thylakoid
cellular_component GO:0005634 nucleus
cellular_component GO:0031972 chloroplast intermembrane space
cellular_component GO:0005783 endoplasmic reticulum
cellular_component GO:0005576 extracellular region
cellular_component GO:0045281 succinate dehydrogenase complex
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0005743 mitochondrial inner membrane
cellular_component GO:0016020 membrane
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0030093 chloroplast photosystem I
cellular_component GO:0005759 mitochondrial matrix
cellular_component GO:0034426 etioplast membrane
cellular_component GO:0031359 integral component of chloroplast outer membrane
cellular_component GO:0046930 pore complex
cellular_component GO:0005739 mitochondrion
cellular_component GO:0005886 plasma membrane
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005778 peroxisomal membrane
cellular_component GO:0000123 histone acetyltransferase complex
cellular_component GO:0080008 Cul4-RING E3 ubiquitin ligase complex
molecular_function GO:0008177 succinate dehydrogenase (ubiquinone) activity
molecular_function GO:0009055 electron transfer activity
molecular_function GO:0051537 2 iron, 2 sulfur cluster binding
molecular_function GO:0015035 protein disulfide oxidoreductase activity
molecular_function GO:0051538 3 iron, 4 sulfur cluster binding
molecular_function GO:0051539 4 iron, 4 sulfur cluster binding
molecular_function GO:0003677 DNA binding
molecular_function GO:0046983 protein dimerization activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0015288 porin activity
molecular_function GO:0022843 voltage-gated cation channel activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0031071 cysteine desulfurase activity
molecular_function GO:0030170 pyridoxal phosphate binding
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0047763 caffeate O-methyltransferase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0004402 histone acetyltransferase activity
molecular_function GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity
molecular_function GO:0042803 protein homodimerization activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004190 aspartic-type endopeptidase activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0016168 chlorophyll binding
molecular_function GO:0004386 helicase activity
RNA-Seq Expression