

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAACATCCCAAAAACGAAGAAAACCTACTGCAAGAACAAAGAGTGCAAGAAGCACACAACCCACAAAGTGACCCAATACAAGAAGGGCAAAGACAGTTTGGCTGCGCAGGGAAAACGCCGTTACGATCGCAAGCAATCTGGCTATGGCGGTCAGACTAAGCCTGTTTTCCACAAGAAGGCTAAGACTACCAAGAAGATTGTTCTGAGGCTTCAGTGTCAGTCGTGCAAGCATGTGTCGCAGCACCCAATTAAGCGTTGCAAGCACTTTGAGATTGGTGGTGATAAGAAGGGCAAGGGTACTACCTTGTTTTAGATGGTGAACATCCCAAAAACGAAGAAAACCTACTGCAAGAACAAAGAGTGCAAGAAGCACACAACCCACAAAGTGACCCAATACAAGAAGGGCAAAGACAGTTTGGCTGCGCAGGGAAAACGCCGTTACGATCGCAAGCAATCTGGCTATGGCGGTCAGACTAAGCCTGTTTTCCACAAGAAGGCTAAGACTACCAAGAAGATTGTTCTGAGGCTTCAGTGTCAGTCGTGCAAGCATGTGTCGCAGCACCCAATTAAGCGTTGCAAGCACTTTGAGATTGGTGGTGATAAGAAGGGCAAGGGTACTACCTTGTTTTAG ATGGTGAACATCCCAAAAACGAAGAAAACCTACTGCAAGAACAAAGAGTGCAAGAAGCACACAACCCACAAAGTGACCCAATACAAGAAGGGCAAAGACAGTTTGGCTGCGCAGGGAAAACGCCGTTACGATCGCAAGCAATCTGGCTATGGCGGTCAGACTAAGCCTGTTTTCCACAAGAAGGCTAAGACTACCAAGAAGATTGTTCTGAGGCTTCAGTGTCAGTCGTGCAAGCATGTGTCGCAGCACCCAATTAAGCGTTGCAAGCACTTTGAGATTGGTGGTGATAAGAAGGGCAAGGGTACTACCTTGTTTTAG MVNIPKTKKTYCKNKECKKHTTHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQSCKHVSQHPIKRCKHFEIGGDKKGKGTTLF Relationships
The following mRNA feature(s) are a part of this gene:
Homology
BLAST of Spo25598.1 vs. NCBI nr
Match: gi|224094107|ref|XP_002310076.1| (hypothetical protein POPTR_0007s07730g [Populus trichocarpa]) HSP 1 Score: 213.4 bits (542), Expect = 1.900e-52 Identity = 102/105 (97.14%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. NCBI nr
Match: gi|590621608|ref|XP_007024824.1| (Zinc-binding ribosomal protein family protein [Theobroma cacao]) HSP 1 Score: 212.2 bits (539), Expect = 4.300e-52 Identity = 101/105 (96.19%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. NCBI nr
Match: gi|769803427|ref|XP_011625945.1| (PREDICTED: 60S ribosomal protein L44 isoform X2 [Amborella trichopoda]) HSP 1 Score: 211.8 bits (538), Expect = 5.600e-52 Identity = 101/105 (96.19%), Postives = 103/105 (98.10%), Query Frame = 1
BLAST of Spo25598.1 vs. NCBI nr
Match: gi|901795705|gb|KMZ58640.1| (60S ribosomal protein L44 [Zostera marina]) HSP 1 Score: 211.1 bits (536), Expect = 9.500e-52 Identity = 100/105 (95.24%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. NCBI nr
Match: gi|460391881|ref|XP_004241547.1| (PREDICTED: 60S ribosomal protein L44 [Solanum lycopersicum]) HSP 1 Score: 210.3 bits (534), Expect = 1.600e-51 Identity = 100/105 (95.24%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Match: A9PD13_POPTR (60S ribosomal protein L36a/L44 OS=Populus trichocarpa GN=POPTR_0007s07730g PE=2 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 1.300e-52 Identity = 102/105 (97.14%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Match: A0A061GCY8_THECC (Zinc-binding ribosomal protein family protein OS=Theobroma cacao GN=TCM_029290 PE=3 SV=1) HSP 1 Score: 212.2 bits (539), Expect = 3.000e-52 Identity = 101/105 (96.19%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Match: A0A0K9NRP7_ZOSMR (60S ribosomal protein L44 OS=Zostera marina GN=ZOSMA_22G01510 PE=3 SV=1) HSP 1 Score: 211.1 bits (536), Expect = 6.600e-52 Identity = 100/105 (95.24%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Match: K4C8M5_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 1.100e-51 Identity = 100/105 (95.24%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Match: Q00508_CANMA (Ribosomal protein L41 OS=Candida maltosa PE=3 SV=1) HSP 1 Score: 209.9 bits (533), Expect = 1.500e-51 Identity = 100/105 (95.24%), Postives = 103/105 (98.10%), Query Frame = 1
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Match: RL44_GOSHI (60S ribosomal protein L44 OS=Gossypium hirsutum GN=RPL44 PE=3 SV=3) HSP 1 Score: 208.8 bits (530), Expect = 3.000e-53 Identity = 99/105 (94.29%), Postives = 103/105 (98.10%), Query Frame = 1
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Match: RL36A_ARATH (60S ribosomal protein L36a OS=Arabidopsis thaliana GN=RPL36AA PE=2 SV=3) HSP 1 Score: 206.8 bits (525), Expect = 1.100e-52 Identity = 100/105 (95.24%), Postives = 101/105 (96.19%), Query Frame = 1
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Match: RL44_PHARH (60S ribosomal protein L44 OS=Phaffia rhodozyma GN=RPL44 PE=3 SV=3) HSP 1 Score: 174.1 bits (440), Expect = 8.100e-43 Identity = 81/104 (77.88%), Postives = 91/104 (87.50%), Query Frame = 1
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Match: RL44_COPC7 (60S ribosomal protein L44 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RPL44 PE=3 SV=2) HSP 1 Score: 172.9 bits (437), Expect = 1.800e-42 Identity = 82/104 (78.85%), Postives = 91/104 (87.50%), Query Frame = 1
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Match: RL44_COPCI (60S ribosomal protein L44 OS=Coprinopsis cinerea GN=RPL44 PE=3 SV=3) HSP 1 Score: 172.9 bits (437), Expect = 1.800e-42 Identity = 82/104 (78.85%), Postives = 91/104 (87.50%), Query Frame = 1
BLAST of Spo25598.1 vs. TAIR (Arabidopsis)
Match: AT3G23390.1 (Zinc-binding ribosomal protein family protein) HSP 1 Score: 206.8 bits (525), Expect = 6.300e-54 Identity = 100/105 (95.24%), Postives = 101/105 (96.19%), Query Frame = 1
BLAST of Spo25598.1 vs. TAIR (Arabidopsis)
Match: AT4G14320.2 (Zinc-binding ribosomal protein family protein) HSP 1 Score: 183.0 bits (463), Expect = 9.800e-47 Identity = 89/93 (95.70%), Postives = 89/93 (95.70%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo25598.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo25598.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo25598.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo25598.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 2
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
RNA-Seq Expression
|