

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGCTACAAGCAGCTTCTTTGGTACCTTCTTCAGTCTCATTTCATAAAGAGGTATGTTTATGATAATCTTGCAATTTTATCATTAAATTAATGTTAATTTTGGTTATCTGTTTAATTTTTTTTATGAAATGTTAAAAGTTTTGGTTGGAATGATATCAGGGGAAATGCATTGGTTTTAAAGAGACATCCTTTTTTGGGGTTTCATTTTCTGATCATTTGAAGGCTGAATTTCATGCTCCATCTTTGAGAATCAAGATGGCGCTACAAGCAGCTTCTTTGGTACCTTCTTCAGTCTCATTTCATAAAGAGGGGAAATGCATTGGTTTTAAAGAGACATCCTTTTTTGGGGTTTCATTTTCTGATCATTTGAAGGCTGAATTTCATGCTCCATCTTTGAGAATCAAG ATGGCGCTACAAGCAGCTTCTTTGGTACCTTCTTCAGTCTCATTTCATAAAGAGGGGAAATGCATTGGTTTTAAAGAGACATCCTTTTTTGGGGTTTCATTTTCTGATCATTTGAAGGCTGAATTTCATGCTCCATCTTTGAGAATCAAG MALQAASLVPSSVSFHKEGKCIGFKETSFFGVSFSDHLKAEFHAPSLRIK Relationships
The following mRNA feature(s) are a part of this gene:
Homology
BLAST of Spo20378.1 vs. NCBI nr
Match: gi|902169173|gb|KNA07626.1| (hypothetical protein SOVF_170120 isoform A [Spinacia oleracea]) HSP 1 Score: 103.2 bits (256), Expect = 1.300e-19 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Spo20378.1 vs. NCBI nr
Match: gi|902169174|gb|KNA07627.1| (hypothetical protein SOVF_170120 isoform B [Spinacia oleracea]) HSP 1 Score: 103.2 bits (256), Expect = 1.300e-19 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Spo20378.1 vs. NCBI nr
Match: gi|731356449|ref|XP_010689680.1| (PREDICTED: protochlorophyllide reductase-like [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 86.3 bits (212), Expect = 1.700e-14 Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 1
BLAST of Spo20378.1 vs. NCBI nr
Match: gi|702364656|ref|XP_010060532.1| (PREDICTED: protochlorophyllide reductase, chloroplastic [Eucalyptus grandis]) HSP 1 Score: 60.1 bits (144), Expect = 1.300e-6 Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of Spo20378.1 vs. NCBI nr
Match: gi|823222044|ref|XP_012443722.1| (PREDICTED: protochlorophyllide reductase, chloroplastic [Gossypium raimondii]) HSP 1 Score: 59.3 bits (142), Expect = 2.200e-6 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QK60_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_170120 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 9.300e-20 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QM45_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_170120 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 9.300e-20 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Match: A0A0J8EG80_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_9g208630 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.200e-14 Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 1
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Match: G5DVX7_SILLA (Protochlorophyllide reductase B (Fragment) OS=Silene latifolia PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 6.000e-11 Identity = 38/50 (76.00%), Postives = 39/50 (78.00%), Query Frame = 1
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Match: G5DVX6_SILLA (Protochlorophyllide reductase B (Fragment) OS=Silene latifolia PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.300e-10 Identity = 38/50 (76.00%), Postives = 39/50 (78.00%), Query Frame = 1
BLAST of Spo20378.1 vs. ExPASy Swiss-Prot
Match: PORA_CUCSA (Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 4.000e-8 Identity = 30/51 (58.82%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Spo20378.1 vs. ExPASy Swiss-Prot
Match: POR_DAUCA (Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 7.600e-7 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 1
BLAST of Spo20378.1 vs. ExPASy Swiss-Prot
Match: PORA_ARATH (Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2) HSP 1 Score: 50.8 bits (120), Expect = 4.900e-6 Identity = 30/55 (54.55%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of Spo20378.1 vs. TAIR (Arabidopsis)
Match: AT5G54190.1 (protochlorophyllide oxidoreductase A) HSP 1 Score: 50.8 bits (120), Expect = 2.800e-7 Identity = 30/55 (54.55%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of Spo20378.1 vs. TAIR (Arabidopsis)
Match: AT1G03630.1 (protochlorophyllide oxidoreductase C) HSP 1 Score: 48.9 bits (115), Expect = 1.100e-6 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 1
BLAST of Spo20378.1 vs. TAIR (Arabidopsis)
Match: AT4G27440.1 (protochlorophyllide oxidoreductase B) HSP 1 Score: 46.2 bits (108), Expect = 6.800e-6 Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo20378.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo20378.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo20378.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 3
BLAST of Spo20378.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 3
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
RNA-Seq Expression
Co-expression
|