Spo17372 (gene)

Overview
NameSpo17372
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_00146 : 402812 .. 403955 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: five_prime_UTRexonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
GTCGTTTTGTCTCTTTCTCCATTTCTCCCAGTTTCCCTTAATTCCCTCAATCCCTCGTGCGCCATTCCTTAACCGACTATTCCCAGTTCCCGGTTACTCCACCCAGTTAACCTTTTTAATTTATTTTTTTGCTCCCAAAATTTTCCCAACTTTCCGTATTATTAAATAATAAAAATAAATTAATTTTACCAACTTTCTCGCTCCTAGTTTTCTGTTCCGTTATCACTATATATGCCTGCTTCACCAACTCATGCTCTTTTTTTCCCTTCCTTCTCCAATTTTCTCTCTCATCGCCGTCGACGACCACCACTCGCAGGCGGTCTCGTCGGCCCATTCCCGCCGTTGATTTCGCCGGAAAACATCACTTTTCCGACTCAACTTATCTCCTTCAGGTCCTCTCTTTCTCCTCTGATCTCTCATTTTCTTTGCAGATCTGATGTTTTTCTCTCCATTACACTTATTTTCTCATTGATTTTCACTTTTTTTTTAATTTTTTTTTTATTGTTGCGTTAACTTCAAGGCTTATACTAGTGTACTTTCTTATTGCTAGATTTAATGTAGATTTTTTTAGCATTTTTAATTTTTGTGATGGATCTGATTTTATGAGCTACTTATCTTACCATTTCATTGTGTTAATGTGCTATGTTTGAGTTAAAATTAACTTATGCACAAAAATAATTCAGGCAATTGTTCAAGTTATGTAAATTATGTCGTTATTTTGTTGGTGTTTATTGTCTAAGGAGCCACGGAGGTAGTGTTGTAGATGTGATTTGATCAAAGGTTTTGGAACCAACATCCACAGATTTTATAGTCCTTAATCCTAGTGTACGTTAGGAATATATTTCAGGATTAGGTTGATTTTGTTTTAAAATAATGTATGTATGTAGAAGACATGATACATGTGCTCATTGTTTTGGATAATGTTTTGTGGAATTGTGGGGTAGCTGGGGCTAACATAACATAACACCAGAGAATCTTTGAAGATCTTGTATGTCCAGTTTGGAGGGCTTATTTTAGGTCTTTCCTTTTGGAAATCTTCTTTGATGTGTCTATAATATTACCATATGTTCTGATTTTTTGAAGTATTTGGACTTATGTAGGTCTTATTATTTGTTATAGAAAGGGTGTTTGTGCGTGTGTTTGA

mRNA sequence

GTCGTTTTGTCTCTTTCTCCATTTCTCCCAGTTTCCCTTAATTCCCTCAATCCCTCGTGCGCCATTCCTTAACCGACTATTCCCAGTTCCCGGTTACTCCACCCAGTTAACCTTTTTAATTTATTTTTTTGCTCCCAAAATTTTCCCAACTTTCCGTATTATTAAATAATAAAAATAAATTAATTTTACCAACTTTCTCGCTCCTAGTTTTCTGTTCCGTTATCACTATATATGCCTGCTTCACCAACTCATGCTCTTTTTTTCCCTTCCTTCTCCAATTTTCTCTCTCATCGCCGTCGACGACCACCACTCGCAGGCGGTCTCGTCGGCCCATTCCCGCCGTTGATTTCGCCGGAAAACATCACTTTTCCGACTCAACTTATCTCCTTCAGAAAGGGTGTTTGTGCGTGTGTTTGA

Coding sequence (CDS)

ATGCCTGCTTCACCAACTCATGCTCTTTTTTTCCCTTCCTTCTCCAATTTTCTCTCTCATCGCCGTCGACGACCACCACTCGCAGGCGGTCTCGTCGGCCCATTCCCGCCGTTGATTTCGCCGGAAAACATCACTTTTCCGACTCAACTTATCTCCTTCAGAAAGGGTGTTTGTGCGTGTGTTTGA

Protein sequence

MPASPTHALFFPSFSNFLSHRRRRPPLAGGLVGPFPPLISPENITFPTQLISFRKGVCACV
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo17372.1Spo17372.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo17372.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17372.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17372.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo17372.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0051301 cell division
biological_process GO:0016567 protein ubiquitination
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0000278 mitotic cell cycle
biological_process GO:0016571 histone methylation
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0010050 vegetative phase change
biological_process GO:0010090 trichome morphogenesis
biological_process GO:0010182 sugar mediated signaling pathway
biological_process GO:0009845 seed germination
biological_process GO:0010162 seed dormancy process
biological_process GO:0050826 response to freezing
biological_process GO:0009909 regulation of flower development
biological_process GO:0033044 regulation of chromosome organization
biological_process GO:0007131 reciprocal meiotic recombination
biological_process GO:0010267 production of ta-siRNAs involved in RNA interference
biological_process GO:0000338 protein deneddylation
biological_process GO:0009790 embryo development
biological_process GO:0010638 positive regulation of organelle organization
biological_process GO:0048235 pollen sperm cell differentiation
biological_process GO:0009640 photomorphogenesis
biological_process GO:0000398 mRNA splicing, via spliceosome
biological_process GO:0006312 mitotic recombination
biological_process GO:0006346 methylation-dependent chromatin silencing
biological_process GO:0010073 meristem maintenance
biological_process GO:0010014 meristem initiation
biological_process GO:0048574 long-day photoperiodism, flowering
biological_process GO:0019915 lipid storage
biological_process GO:0016572 histone phosphorylation
biological_process GO:0051567 histone H3-K9 methylation
biological_process GO:0009560 embryo sac egg cell differentiation
biological_process GO:0043687 post-translational protein modification
biological_process GO:0016579 protein deubiquitination
biological_process GO:0006281 DNA repair
biological_process GO:0006465 signal peptide processing
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006506 GPI anchor biosynthetic process
biological_process GO:0009651 response to salt stress
biological_process GO:0051788 response to misfolded protein
biological_process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
biological_process GO:0080129 proteasome core complex assembly
biological_process GO:0006094 gluconeogenesis
biological_process GO:0006623 protein targeting to vacuole
biological_process GO:0016558 protein import into peroxisome matrix
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0006635 fatty acid beta-oxidation
biological_process GO:0009932 cell tip growth
biological_process GO:0009407 toxin catabolic process
biological_process GO:0034314 Arp2/3 complex-mediated actin nucleation
biological_process GO:0006508 proteolysis
biological_process GO:0032447 protein urmylation
biological_process GO:0008152 metabolic process
biological_process GO:0005985 sucrose metabolic process
biological_process GO:0005982 starch metabolic process
biological_process GO:0030001 metal ion transport
biological_process GO:0046686 response to cadmium ion
biological_process GO:0006301 postreplication repair
biological_process GO:0006850 mitochondrial pyruvate transmembrane transport
biological_process GO:0006096 glycolytic process
biological_process GO:0009060 aerobic respiration
biological_process GO:0002098 tRNA wobble uridine modification
biological_process GO:0034227 tRNA thio-modification
biological_process GO:0009410 response to xenobiotic stimulus
biological_process GO:0000302 response to reactive oxygen species
biological_process GO:0080157 regulation of plant-type cell wall organization or biogenesis
biological_process GO:0009793 embryo development ending in seed dormancy
biological_process GO:0035196 production of miRNAs involved in gene silencing by miRNA
biological_process GO:0006306 DNA methylation
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0006396 RNA processing
biological_process GO:0006412 translation
biological_process GO:0001510 RNA methylation
biological_process GO:0042254 ribosome biogenesis
biological_process GO:0009664 plant-type cell wall organization
biological_process GO:0042545 cell wall modification
biological_process GO:0009855 determination of bilateral symmetry
biological_process GO:0000186 activation of MAPKK activity
biological_process GO:0016049 cell growth
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0016123 xanthophyll biosynthetic process
biological_process GO:0010103 stomatal complex morphogenesis
biological_process GO:0009765 photosynthesis, light harvesting
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0016120 carotene biosynthetic process
biological_process GO:0043631 RNA polyadenylation
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0007178 transmembrane receptor protein serine/threonine kinase signaling pathway
biological_process GO:0000902 cell morphogenesis
biological_process GO:0007267 cell-cell signaling
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0007033 vacuole organization
biological_process GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0006468 protein phosphorylation
biological_process GO:0048193 Golgi vesicle transport
biological_process GO:0006979 response to oxidative stress
biological_process GO:0006338 chromatin remodeling
biological_process GO:0031048 chromatin silencing by small RNA
biological_process GO:0007030 Golgi organization
cellular_component GO:0005634 nucleus
cellular_component GO:0005886 plasma membrane
cellular_component GO:0005801 cis-Golgi network
cellular_component GO:0005768 endosome
cellular_component GO:0005797 Golgi medial cisterna
cellular_component GO:0005774 vacuolar membrane
cellular_component GO:0033179 proton-transporting V-type ATPase, V0 domain
cellular_component GO:0005829 cytosol
cellular_component GO:0017177 glucosidase II complex
cellular_component GO:0005840 ribosome
cellular_component GO:0000139 Golgi membrane
cellular_component GO:0031410 cytoplasmic vesicle
cellular_component GO:0005839 proteasome core complex
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005743 mitochondrial inner membrane
cellular_component GO:0009524 phragmoplast
cellular_component GO:0042995 cell projection
cellular_component GO:0031969 chloroplast membrane
cellular_component GO:0030659 cytoplasmic vesicle membrane
cellular_component GO:0005885 Arp2/3 protein complex
cellular_component GO:0005802 trans-Golgi network
cellular_component GO:0009507 chloroplast
cellular_component GO:0005618 cell wall
cellular_component GO:0000812 Swr1 complex
cellular_component GO:0005737 cytoplasm
cellular_component GO:0035267 NuA4 histone acetyltransferase complex
cellular_component GO:0031011 Ino80 complex
cellular_component GO:0009506 plasmodesma
cellular_component GO:0005856 cytoskeleton
cellular_component GO:0022627 cytosolic small ribosomal subunit
cellular_component GO:0035145 exon-exon junction complex
cellular_component GO:0016604 nuclear body
cellular_component GO:0005730 nucleolus
cellular_component GO:0005576 extracellular region
molecular_function GO:0005515 protein binding
molecular_function GO:0004683 calmodulin-dependent protein kinase activity
molecular_function GO:0004652 polynucleotide adenylyltransferase activity
molecular_function GO:0004298 threonine-type endopeptidase activity
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0019706 protein-cysteine S-palmitoyltransferase activity
molecular_function GO:0000035 acyl binding
molecular_function GO:0003723 RNA binding
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0016758 transferase activity, transferring hexosyl groups
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0003779 actin binding
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0033926 glycopeptide alpha-N-acetylgalactosaminidase activity
molecular_function GO:0016740 transferase activity
molecular_function GO:0015078 proton transmembrane transporter activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004709 MAP kinase kinase kinase activity
molecular_function GO:0000049 tRNA binding
molecular_function GO:0004721 phosphoprotein phosphatase activity
molecular_function GO:0016779 nucleotidyltransferase activity
molecular_function GO:0004535 poly(A)-specific ribonuclease activity
molecular_function GO:0004575 sucrose alpha-glucosidase activity
molecular_function GO:0005200 structural constituent of cytoskeleton
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
molecular_function GO:0008233 peptidase activity
molecular_function GO:0045435 lycopene epsilon cyclase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003735 structural constituent of ribosome
molecular_function GO:0004601 peroxidase activity
molecular_function GO:0003676 nucleic acid binding
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo173710.73Barchart | Table
Spo141940.72Barchart | Table
Spo271020.72Barchart | Table
Spo085400.72Barchart | Table
Spo227600.70Barchart | Table
Spo156030.69Barchart | Table
Spo010690.69Barchart | Table
Spo008980.69Barchart | Table
Spo033060.69Barchart | Table
Spo209570.69Barchart | Table
Spo146870.68Barchart | Table
Spo098030.68Barchart | Table
Spo036180.68Barchart | Table
Spo050290.68Barchart | Table
Spo054130.68Barchart | Table
Spo246250.68Barchart | Table
Spo122530.68Barchart | Table
Spo169450.68Barchart | Table
Spo020850.68Barchart | Table
Spo222560.68Barchart | Table
Spo121760.67Barchart | Table
Spo009360.67Barchart | Table
Spo012610.67Barchart | Table
Spo071840.67Barchart | Table
Spo140080.67Barchart | Table
Spo195580.67Barchart | Table
Spo200710.67Barchart | Table
Spo231230.67Barchart | Table
Spo258810.67Barchart | Table
Spo173910.66Barchart | Table
Spo192060.66Barchart | Table
Spo006060.66Barchart | Table
Spo148490.66Barchart | Table
Spo236640.66Barchart | Table
Spo075860.66Barchart | Table
Spo173290.66Barchart | Table
Spo072650.66Barchart | Table
Spo122020.66Barchart | Table
Spo216910.66Barchart | Table
Spo146610.66Barchart | Table
Spo134590.65Barchart | Table
Spo240920.65Barchart | Table
Spo144410.65Barchart | Table
Spo036080.65Barchart | Table
Spo110270.65Barchart | Table
Spo163820.65Barchart | Table
Spo019140.65Barchart | Table
Spo195990.65Barchart | Table
Spo258510.65Barchart | Table
Spo004670.65Barchart | Table
Spo029620.65Barchart | Table
Spo026060.65Barchart | Table
Spo233460.65Barchart | Table
Spo239080.65Barchart | Table