Spo14309 (gene)

Overview
NameSpo14309
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_00860 : 231311 .. 232430 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGATGAGGTCTCCAGTCTCTACACTAAATAGTTTGCATGGTTCTAAGAAGTTTACCTTTAAATTTACATATCGTAACTCGTTCTGTTCAAAATTGTGCTCAAATATTCACCATGCTCCTCATAGTACCTTGTTGTTCATCCACCTTTTTTTTCCAGACTGCCTAGAAAACTTGGACAATGTGGGGGGGGGGGGGGGNGGGGGGTTGGGGTTGGGGTTGCCTTTTTGTTTACTGTCACCTGGTTACCATCTAGAATATACTATCTAGTATCTACTTTGCTGGGTTTTTACCTTGTGGCTATTTGCTTATTTGTCTTTTACCATGATTCATCGCTTATCCACTTCTAGGCTCCCAGCTGCTGTGCTGCTCAGACTGTCTCCCTAGTGTCGCACGAAGGAGTGTATTGAGACCATGAGAGAATGACTATAACCTTTATTTAGATGGGAGACTATAATCTTTAGAAGTTTAGTCTGTGTCAAGCATAAGATAGTATGGTTAAATCAACTGTCTGAGTAACAAGGCCCAGCCGCCCAGAAAATGAGGGATTTTGGTAGAACAAAGTTATGTCAAAATTATATGCATACTGAACTTGTAAAATGTTACGGAATTAATGTCAAAGTTATATGCATATTGAATGTATAAGTGTATATTCGGGCTTTCTTTATTTAGTGAGATACGGAGTACTTAGTTTTGAATTATCAAGCTAGGCTTTAGCTCCAAACATTGCTCAACACTTAAGGAATTGGTATCTGTTTGGATCAAGATCAACTACTAAATTCTTTTTCATTCCATGTCCAGTCTTGACTTAAATTGTGTCATAAGTTCTGATTGAGGTGGCAGATGCACAGCCCAGTTACTGATGAAGAATGGCAGTGTAGTTGACAAGCTAGTTGGAGCGAATCCGGATGAGATAAGGAAAAGGGTCGGAAGTTTTATTCAGACCACCGGTGGCGGTGCATATATGCCCTAGTCGTCTTTTTGTGTGTTTCGTGTTGTACATTTTGCTCATTTCTTTACACTCCGCAGCACTGCAGCAGTGTGCTGTCTAACAGCTCGATATATGTTAAAAACAAATACATGAATGTATGGCCATATGTGTATGTAAGATTAATTTGTTAA

mRNA sequence

ATGGATGAGGGTCGGAAGTTTTATTCAGACCACCGGTGGCGGTGCATATATGCCCTAGTCGTCTTTTTGTGTGTTTCGTGTTGTACATTTTGCTCATTTCTTTACACTCCGCAGCACTGCAGCAGTGTGCTGTCTAACAGCTCGATATATGTTAAAAACAAATACATGAATGTATGGCCATATGTGTATGTAAGATTAATTTGTTAA

Coding sequence (CDS)

ATGGATGAGGGTCGGAAGTTTTATTCAGACCACCGGTGGCGGTGCATATATGCCCTAGTCGTCTTTTTGTGTGTTTCGTGTTGTACATTTTGCTCATTTCTTTACACTCCGCAGCACTGCAGCAGTGTGCTGTCTAACAGCTCGATATATGTTAAAAACAAATACATGAATGTATGGCCATATGTGTATGTAAGATTAATTTGTTAA

Protein sequence

MDEGRKFYSDHRWRCIYALVVFLCVSCCTFCSFLYTPQHCSSVLSNSSIYVKNKYMNVWPYVYVRLIC
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo14309.1Spo14309.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo14309.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo14309.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo14309.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo14309.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007267 cell-cell signaling
biological_process GO:0006531 aspartate metabolic process
biological_process GO:0009553 embryo sac development
biological_process GO:0006406 mRNA export from nucleus
biological_process GO:0009658 chloroplast organization
biological_process GO:0071897 DNA biosynthetic process
biological_process GO:0006260 DNA replication
biological_process GO:0006522 alanine metabolic process
biological_process GO:0006529 asparagine biosynthetic process
biological_process GO:0006536 glutamate metabolic process
biological_process GO:0009657 plastid organization
biological_process GO:0006541 glutamine metabolic process
biological_process GO:0006177 GMP biosynthetic process
biological_process GO:0006821 chloride transport
biological_process GO:0034220 ion transmembrane transport
biological_process GO:0044070 regulation of anion transport
biological_process GO:0006397 mRNA processing
biological_process GO:0055122 response to very low light intensity stimulus
biological_process GO:0006508 proteolysis
biological_process GO:0009250 glucan biosynthetic process
biological_process GO:0010207 photosystem II assembly
biological_process GO:0009987 cellular process
biological_process GO:0006281 DNA repair
biological_process GO:0006554 lysine catabolic process
biological_process GO:0006144 purine nucleobase metabolic process
biological_process GO:0006206 pyrimidine nucleobase metabolic process
biological_process GO:0006351 transcription, DNA-templated
biological_process GO:0001510 RNA methylation
biological_process GO:0042254 ribosome biogenesis
biological_process GO:0006412 translation
biological_process GO:0006139 nucleobase-containing compound metabolic process
biological_process GO:0006783 heme biosynthetic process
biological_process GO:0006098 pentose-phosphate shunt
biological_process GO:0016192 vesicle-mediated transport
biological_process GO:0042967 obsolete acyl-carrier-protein biosynthetic process
biological_process GO:0000398 mRNA splicing, via spliceosome
biological_process GO:0009220 pyrimidine ribonucleotide biosynthetic process
biological_process GO:0006487 protein N-linked glycosylation
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0006354 DNA-templated transcription, elongation
biological_process GO:0009058 biosynthetic process
biological_process GO:0034660 ncRNA metabolic process
biological_process GO:0006566 threonine metabolic process
biological_process GO:0000957 mitochondrial RNA catabolic process
biological_process GO:0009718 anthocyanin-containing compound biosynthetic process
biological_process GO:0061077 chaperone-mediated protein folding
biological_process GO:0006432 phenylalanyl-tRNA aminoacylation
biological_process GO:0006457 protein folding
biological_process GO:0009408 response to heat
biological_process GO:0000478 endonucleolytic cleavage involved in rRNA processing
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0000963 mitochondrial RNA processing
biological_process GO:0042273 ribosomal large subunit biogenesis
biological_process GO:0006402 mRNA catabolic process
biological_process GO:0042991 obsolete transcription factor import into nucleus
biological_process GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
biological_process GO:0008033 tRNA processing
biological_process GO:0043419 urea catabolic process
biological_process GO:0009063 cellular amino acid catabolic process
biological_process GO:0044237 cellular metabolic process
biological_process GO:0006446 regulation of translational initiation
biological_process GO:0000055 ribosomal large subunit export from nucleus
biological_process GO:0030036 actin cytoskeleton organization
biological_process GO:0016310 phosphorylation
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0007049 cell cycle
biological_process GO:0051301 cell division
biological_process GO:0010020 chloroplast fission
biological_process GO:0009902 chloroplast relocation
biological_process GO:0007017 microtubule-based process
biological_process GO:0051258 protein polymerization
biological_process GO:0009637 response to blue light
biological_process GO:0032502 developmental process
biological_process GO:0051083 'de novo' cotranslational protein folding
biological_process GO:0006265 DNA topological change
biological_process GO:0043488 regulation of mRNA stability
biological_process GO:0006449 regulation of translational termination
biological_process GO:0051252 regulation of RNA metabolic process
biological_process GO:0006396 RNA processing
biological_process GO:0009094 L-phenylalanine biosynthetic process
biological_process GO:0000162 tryptophan biosynthetic process
biological_process GO:0006571 tyrosine biosynthetic process
biological_process GO:0006437 tyrosyl-tRNA aminoacylation
biological_process GO:0034968 histone lysine methylation
biological_process GO:0006468 protein phosphorylation
biological_process GO:0006560 proline metabolic process
biological_process GO:0032508 DNA duplex unwinding
biological_process GO:0006606 protein import into nucleus
biological_process GO:0009933 meristem structural organization
biological_process GO:0000226 microtubule cytoskeleton organization
biological_process GO:0031408 oxylipin biosynthetic process
biological_process GO:0006733 oxidoreduction coenzyme metabolic process
biological_process GO:0009117 nucleotide metabolic process
biological_process GO:0009106 lipoate metabolic process
biological_process GO:0051026 chiasma assembly
biological_process GO:0006312 mitotic recombination
biological_process GO:0009965 leaf morphogenesis
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0009640 photomorphogenesis
biological_process GO:0009695 jasmonic acid biosynthetic process
biological_process GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
biological_process GO:0006546 glycine catabolic process
biological_process GO:0019216 regulation of lipid metabolic process
biological_process GO:0009073 aromatic amino acid family biosynthetic process
biological_process GO:0008152 metabolic process
biological_process GO:0010267 production of ta-siRNAs involved in RNA interference
biological_process GO:0009909 regulation of flower development
biological_process GO:0035196 production of miRNAs involved in gene silencing by miRNA
biological_process GO:0022618 ribonucleoprotein complex assembly
biological_process GO:0007062 sister chromatid cohesion
biological_process GO:0016117 carotenoid biosynthetic process
biological_process GO:0019344 cysteine biosynthetic process
biological_process GO:0030154 cell differentiation
biological_process GO:0015995 chlorophyll biosynthetic process
biological_process GO:0010564 regulation of cell cycle process
biological_process GO:0000278 mitotic cell cycle
biological_process GO:0042138 meiotic DNA double-strand break formation
biological_process GO:0009108 coenzyme biosynthetic process
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0006655 phosphatidylglycerol biosynthetic process
biological_process GO:0007346 regulation of mitotic cell cycle
biological_process GO:0010182 sugar mediated signaling pathway
biological_process GO:0006302 double-strand break repair
biological_process GO:0006563 L-serine metabolic process
biological_process GO:0006426 glycyl-tRNA aminoacylation
biological_process GO:0009793 embryo development ending in seed dormancy
biological_process GO:0006544 glycine metabolic process
biological_process GO:0006420 arginyl-tRNA aminoacylation
biological_process GO:0006525 arginine metabolic process
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0010048 vernalization response
biological_process GO:0009560 embryo sac egg cell differentiation
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0009416 response to light stimulus
biological_process GO:0016233 telomere capping
biological_process GO:0009845 seed germination
biological_process GO:0006766 vitamin metabolic process
biological_process GO:0000304 response to singlet oxygen
biological_process GO:0051321 meiotic cell cycle
biological_process GO:0006364 rRNA processing
biological_process GO:0009165 nucleotide biosynthetic process
biological_process GO:0010162 seed dormancy process
biological_process GO:0006636 unsaturated fatty acid biosynthetic process
biological_process GO:0019748 secondary metabolic process
biological_process GO:0050826 response to freezing
biological_process GO:0019915 lipid storage
biological_process GO:0016567 protein ubiquitination
cellular_component GO:0018444 translation release factor complex
cellular_component GO:0009534 chloroplast thylakoid
cellular_component GO:0019013 viral nucleocapsid
cellular_component GO:0005874 microtubule
cellular_component GO:0000781 chromosome, telomeric region
cellular_component GO:0005657 replication fork
cellular_component GO:0005667 transcription factor complex
cellular_component GO:0009328 phenylalanine-tRNA ligase complex
cellular_component GO:1990904 ribonucleoprotein complex
cellular_component GO:0030870 Mre11 complex
cellular_component GO:0009345 glycine-tRNA ligase complex
cellular_component GO:0005694 chromosome
cellular_component GO:0005829 cytosol
cellular_component GO:0000785 chromatin
cellular_component GO:0009941 chloroplast envelope
cellular_component GO:0005850 eukaryotic translation initiation factor 2 complex
cellular_component GO:0009507 chloroplast
cellular_component GO:0005739 mitochondrion
cellular_component GO:0005730 nucleolus
cellular_component GO:0009295 nucleoid
cellular_component GO:0009536 plastid
cellular_component GO:0005886 plasma membrane
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009535 chloroplast thylakoid membrane
cellular_component GO:0005840 ribosome
cellular_component GO:0031969 chloroplast membrane
cellular_component GO:0032040 small-subunit processome
cellular_component GO:0016020 membrane
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0005634 nucleus
cellular_component GO:0015030 Cajal body
cellular_component GO:0080008 Cul4-RING E3 ubiquitin ligase complex
cellular_component GO:0016363 nuclear matrix
cellular_component GO:0005732 small nucleolar ribonucleoprotein complex
cellular_component GO:0005737 cytoplasm
cellular_component GO:0042575 DNA polymerase complex
molecular_function GO:0008422 beta-glucosidase activity
molecular_function GO:0000175 3'-5'-exoribonuclease activity
molecular_function GO:0044183 protein binding involved in protein folding
molecular_function GO:0031072 heat shock protein binding
molecular_function GO:0004540 ribonuclease activity
molecular_function GO:0016151 nickel cation binding
molecular_function GO:0004831 tyrosine-tRNA ligase activity
molecular_function GO:0004654 polyribonucleotide nucleotidyltransferase activity
molecular_function GO:0004826 phenylalanine-tRNA ligase activity
molecular_function GO:0008568 microtubule-severing ATPase activity
molecular_function GO:0051082 unfolded protein binding
molecular_function GO:0016829 lyase activity
molecular_function GO:0000049 tRNA binding
molecular_function GO:0003918 DNA topoisomerase type II (ATP-hydrolyzing) activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0016462 pyrophosphatase activity
molecular_function GO:0003922 GMP synthase (glutamine-hydrolyzing) activity
molecular_function GO:0004066 asparagine synthase (glutamine-hydrolyzing) activity
molecular_function GO:0003887 DNA-directed DNA polymerase activity
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
molecular_function GO:0043169 cation binding
molecular_function GO:0019843 rRNA binding
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0008080 N-acetyltransferase activity
molecular_function GO:0004386 helicase activity
molecular_function GO:0003723 RNA binding
molecular_function GO:0003735 structural constituent of ribosome
molecular_function GO:0008146 sulfotransferase activity
molecular_function GO:0003899 DNA-directed 5'-3' RNA polymerase activity
molecular_function GO:0003677 DNA binding
molecular_function GO:0018024 histone-lysine N-methyltransferase activity
molecular_function GO:0042393 histone binding
molecular_function GO:0004820 glycine-tRNA ligase activity
molecular_function GO:0004814 arginine-tRNA ligase activity
molecular_function GO:0016740 transferase activity
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0003747 translation release factor activity
molecular_function GO:0003924 GTPase activity
molecular_function GO:0016887 ATPase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004518 nuclease activity
molecular_function GO:0016987 sigma factor activity
molecular_function GO:0003700 DNA-binding transcription factor activity
molecular_function GO:0008270 zinc ion binding
molecular_function GO:0043621 protein self-association
molecular_function GO:0042802 identical protein binding
molecular_function GO:0005525 GTP binding
molecular_function GO:0005488 binding
molecular_function GO:0005247 voltage-gated chloride channel activity
molecular_function GO:0005515 protein binding
molecular_function GO:0016301 kinase activity
molecular_function GO:0070008 serine-type exopeptidase activity
molecular_function GO:0004252 serine-type endopeptidase activity
molecular_function GO:0008026 ATP-dependent helicase activity
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0003678 DNA helicase activity
molecular_function GO:0003682 chromatin binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0003743 translation initiation factor activity
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo184790.78Barchart | Table
Spo126100.76Barchart | Table
Spo088490.76Barchart | Table
Spo264520.76Barchart | Table
Spo197760.76Barchart | Table
Spo018310.75Barchart | Table
Spo239780.75Barchart | Table
Spo135090.75Barchart | Table
Spo108560.75Barchart | Table
Spo194990.74Barchart | Table
Spo225250.74Barchart | Table
Spo231270.74Barchart | Table
Spo111800.74Barchart | Table
Spo269780.74Barchart | Table
Spo094930.74Barchart | Table
Spo030530.74Barchart | Table
Spo184800.73Barchart | Table
Spo127640.73Barchart | Table
Spo110930.73Barchart | Table
Spo251230.73Barchart | Table
Spo216460.72Barchart | Table
Spo185070.72Barchart | Table
Spo188600.72Barchart | Table
Spo254760.72Barchart | Table
Spo051900.72Barchart | Table
Spo022710.72Barchart | Table
Spo083350.72Barchart | Table
Spo002630.72Barchart | Table
Spo121430.72Barchart | Table
Spo132040.72Barchart | Table
Spo132410.72Barchart | Table
Spo005540.72Barchart | Table
Spo039140.72Barchart | Table
Spo152350.71Barchart | Table
Spo061370.71Barchart | Table
Spo059410.71Barchart | Table
Spo258460.71Barchart | Table
Spo099590.71Barchart | Table
Spo208890.71Barchart | Table
Spo117560.70Barchart | Table
Spo030590.70Barchart | Table
Spo045010.70Barchart | Table
Spo143100.70Barchart | Table
Spo176950.70Barchart | Table
Spo183930.70Barchart | Table
Spo216480.70Barchart | Table
Spo202430.70Barchart | Table
Spo171140.70Barchart | Table
Spo170810.70Barchart | Table
Spo052080.69Barchart | Table
Spo006700.69Barchart | Table
Spo243660.69Barchart | Table
Spo154070.69Barchart | Table
Spo154310.69Barchart | Table
Spo257490.69Barchart | Table
Spo107020.69Barchart | Table
Spo263300.69Barchart | Table
Spo088790.69Barchart | Table
Spo048510.68Barchart | Table
Spo019970.68Barchart | Table
Spo168730.68Barchart | Table
Spo271000.68Barchart | Table
Spo195190.68Barchart | Table
Spo190980.68Barchart | Table
Spo184190.68Barchart | Table
Spo173050.68Barchart | Table
Spo001290.68Barchart | Table
Spo182960.68Barchart | Table
Spo261950.68Barchart | Table
Spo149830.68Barchart | Table
Spo260080.68Barchart | Table
Spo157970.68Barchart | Table
Spo043500.68Barchart | Table
Spo044530.68Barchart | Table
Spo217220.68Barchart | Table
Spo017030.68Barchart | Table
Spo046690.68Barchart | Table
Spo064550.67Barchart | Table
Spo144080.67Barchart | Table
Spo012010.67Barchart | Table
Spo148840.67Barchart | Table
Spo051370.67Barchart | Table
Spo036270.67Barchart | Table
Spo266320.67Barchart | Table
Spo154010.67Barchart | Table
Spo020150.67Barchart | Table
Spo248720.67Barchart | Table
Spo018280.67Barchart | Table
Spo155520.67Barchart | Table
Spo107980.67Barchart | Table
Spo110720.67Barchart | Table
Spo156560.67Barchart | Table
Spo044900.67Barchart | Table
Spo195000.67Barchart | Table
Spo089980.67Barchart | Table
Spo269790.67Barchart | Table
Spo043230.67Barchart | Table
Spo013140.67Barchart | Table
Spo068810.67Barchart | Table
Spo219100.67Barchart | Table
Spo244400.67Barchart | Table
Spo225660.67Barchart | Table
Spo271440.67Barchart | Table
Spo175130.66Barchart | Table
Spo007020.66Barchart | Table
Spo010010.66Barchart | Table
Spo028550.66Barchart | Table
Spo030570.66Barchart | Table
Spo032210.66Barchart | Table
Spo033580.66Barchart | Table
Spo038840.66Barchart | Table
Spo046220.66Barchart | Table
Spo049750.66Barchart | Table
Spo049880.66Barchart | Table
Spo057320.66Barchart | Table
Spo062870.66Barchart | Table
Spo065910.66Barchart | Table
Spo081060.66Barchart | Table
Spo085330.66Barchart | Table
Spo087650.66Barchart | Table
Spo090270.66Barchart | Table
Spo090280.66Barchart | Table
Spo100720.66Barchart | Table
Spo140130.66Barchart | Table
Spo148330.66Barchart | Table
Spo151340.66Barchart | Table
Spo156890.66Barchart | Table
Spo157310.66Barchart | Table
Spo163940.66Barchart | Table
Spo168170.66Barchart | Table
Spo180960.66Barchart | Table
Spo181500.66Barchart | Table
Spo189420.66Barchart | Table
Spo191950.66Barchart | Table
Spo216190.66Barchart | Table
Spo227120.66Barchart | Table
Spo228040.66Barchart | Table
Spo238660.66Barchart | Table
Spo245030.66Barchart | Table
Spo250810.66Barchart | Table
Spo257480.66Barchart | Table
Spo260680.66Barchart | Table
Spo271040.66Barchart | Table
Spo208060.65Barchart | Table
Spo038350.65Barchart | Table
Spo196400.65Barchart | Table
Spo195060.65Barchart | Table
Spo030270.65Barchart | Table
Spo193880.65Barchart | Table
Spo165680.65Barchart | Table
Spo154820.65Barchart | Table
Spo021810.65Barchart | Table
Spo137800.65Barchart | Table
Spo132380.65Barchart | Table
Spo092330.65Barchart | Table
Spo064420.65Barchart | Table
Spo239390.65Barchart | Table
Spo226610.65Barchart | Table
Spo214740.65Barchart | Table
Spo209410.65Barchart | Table
Spo057150.65Barchart | Table