Spo11000 (gene)

Overview
NameSpo11000
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
Locationchr4 : 116903409 .. 116903624 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCTCAATAGTCATTACACCAGAATACCAAATGTCTTGATTTGTCCCTCTAAACTCTTCGCCGCCGAAATCAAACTCCCTCGCTCTTTCCACTTTCACAGTTCATGCACCCCATTTTCTTCTCTCTCTGAAAATTTCGATTTCCCCCAATTTTCTAAGCAATTTGTTGTTCCTTCCCAATTTCCGATCACATTGTACCCCCAAACCCTACACTGA

mRNA sequence

ATGCTCAATAGTCATTACACCAGAATACCAAATGTCTTGATTTGTCCCTCTAAACTCTTCGCCGCCGAAATCAAACTCCCTCGCTCTTTCCACTTTCACAGTTCATGCACCCCATTTTCTTCTCTCTCTGAAAATTTCGATTTCCCCCAATTTTCTAAGCAATTTGTTGTTCCTTCCCAATTTCCGATCACATTGTACCCCCAAACCCTACACTGA

Coding sequence (CDS)

ATGCTCAATAGTCATTACACCAGAATACCAAATGTCTTGATTTGTCCCTCTAAACTCTTCGCCGCCGAAATCAAACTCCCTCGCTCTTTCCACTTTCACAGTTCATGCACCCCATTTTCTTCTCTCTCTGAAAATTTCGATTTCCCCCAATTTTCTAAGCAATTTGTTGTTCCTTCCCAATTTCCGATCACATTGTACCCCCAAACCCTACACTGA

Protein sequence

MLNSHYTRIPNVLICPSKLFAAEIKLPRSFHFHSSCTPFSSLSENFDFPQFSKQFVVPSQFPITLYPQTLH
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo11000.1Spo11000.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo11000.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11000.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11000.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo11000.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0032502 developmental process
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0016126 sterol biosynthetic process
biological_process GO:0015994 chlorophyll metabolic process
biological_process GO:0006399 tRNA metabolic process
biological_process GO:0006364 rRNA processing
biological_process GO:0044206 UMP salvage
biological_process GO:0045893 positive regulation of transcription, DNA-templated
biological_process GO:0042793 plastid transcription
biological_process GO:0045036 protein targeting to chloroplast
biological_process GO:0034051 negative regulation of plant-type hypersensitive response
biological_process GO:0006662 glycerol ether metabolic process
biological_process GO:0009658 chloroplast organization
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0006223 uracil salvage
cellular_component GO:0010007 magnesium chelatase complex
cellular_component GO:0009570 chloroplast stroma
cellular_component GO:0009579 thylakoid
cellular_component GO:0009295 nucleoid
cellular_component GO:0009507 chloroplast
cellular_component GO:0005829 cytosol
molecular_function GO:0009055 electron transfer activity
molecular_function GO:0005515 protein binding
molecular_function GO:0015035 protein disulfide oxidoreductase activity
molecular_function GO:0047134 protein-disulfide reductase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0004845 uracil phosphoribosyltransferase activity
molecular_function GO:0016851 magnesium chelatase activity
molecular_function GO:0046422 violaxanthin de-epoxidase activity
RNA-Seq Expression