Spo09636 (gene)

Overview
NameSpo09636
Typegene
OrganismSpinacia oleracea (Spinach)
DescriptionUnknown protein
LocationSpoScf_01319 : 104706 .. 104948 (-)
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

mRNA sequence

ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

Coding sequence (CDS)

ATGGTTAACAAATCAATTTCCTACCTTTCCAACTCATCACGCGTCATCACCGAAACTTCCGGTCATCCTGCCACTTTTTCTCTCTCCTCCTACTCCTTTTTAATCCCTTCCCCTTCTTTCTCCCACCCATTTTTTCTCACTCAACTGTCAACTCCATTGCAATTTCCAAACGAACAAACATCACCCTTATTATTTTTGTCAAACAAAAAAAAAAATCATAAAATGTCAAAGCAGTTTCCTTAG

Protein sequence

MVNKSISYLSNSSRVITETSGHPATFSLSSYSFLIPSPSFSHPFFLTQLSTPLQFPNEQTSPLLFLSNKKKNHKMSKQFP
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Spo09636.1Spo09636.1mRNA


Homology
The following BLAST results are available for this feature:
BLAST of Spo09636.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo09636.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo09636.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spo09636.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016567 protein ubiquitination
biological_process GO:0009698 phenylpropanoid metabolic process
biological_process GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway
biological_process GO:0007178 transmembrane receptor protein serine/threonine kinase signaling pathway
biological_process GO:0006470 protein dephosphorylation
biological_process GO:0030968 endoplasmic reticulum unfolded protein response
biological_process GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway
biological_process GO:0008152 metabolic process
biological_process GO:2000030 regulation of response to red or far red light
biological_process GO:0010046 response to mycotoxin
biological_process GO:0052542 defense response by callose deposition
biological_process GO:0030001 metal ion transport
biological_process GO:0019722 calcium-mediated signaling
biological_process GO:0007267 cell-cell signaling
biological_process GO:0042398 cellular modified amino acid biosynthetic process
biological_process GO:0006598 polyamine catabolic process
biological_process GO:0009697 salicylic acid biosynthetic process
biological_process GO:0048767 root hair elongation
biological_process GO:0010167 response to nitrate
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0015706 nitrate transport
biological_process GO:0042218 1-aminocyclopropane-1-carboxylate biosynthetic process
biological_process GO:0006520 cellular amino acid metabolic process
biological_process GO:0006952 defense response
biological_process GO:0009693 ethylene biosynthetic process
biological_process GO:0009835 fruit ripening
biological_process GO:0009737 response to abscisic acid
biological_process GO:0010200 response to chitin
biological_process GO:0009723 response to ethylene
biological_process GO:0006468 protein phosphorylation
biological_process GO:0006073 cellular glucan metabolic process
biological_process GO:0009069 serine family amino acid metabolic process
biological_process GO:0071555 cell wall organization
biological_process GO:0010224 response to UV-B
biological_process GO:0019684 photosynthesis, light reaction
biological_process GO:0006857 oligopeptide transport
biological_process GO:0016310 phosphorylation
biological_process GO:0009741 response to brassinosteroid
biological_process GO:0009738 abscisic acid-activated signaling pathway
biological_process GO:0000169 activation of MAPK activity involved in osmosensory signaling pathway
biological_process GO:0010120 camalexin biosynthetic process
biological_process GO:0042742 defense response to bacterium
biological_process GO:0050832 defense response to fungus
biological_process GO:0001666 response to hypoxia
biological_process GO:0010229 inflorescence development
biological_process GO:0009867 jasmonic acid mediated signaling pathway
biological_process GO:0031348 negative regulation of defense response
biological_process GO:0043069 negative regulation of programmed cell death
biological_process GO:0009595 detection of biotic stimulus
biological_process GO:0009409 response to cold
biological_process GO:0010363 regulation of plant-type hypersensitive response
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:2000037 regulation of stomatal complex patterning
biological_process GO:2000038 regulation of stomatal complex development
biological_process GO:0035304 regulation of protein dephosphorylation
biological_process GO:0043900 regulation of multi-organism process
biological_process GO:0048481 plant ovule development
biological_process GO:0080136 priming of cellular response to stress
biological_process GO:0010310 regulation of hydrogen peroxide metabolic process
biological_process GO:0006612 protein targeting to membrane
cellular_component GO:0005618 cell wall
cellular_component GO:0005834 heterotrimeric G-protein complex
cellular_component GO:0000785 chromatin
cellular_component GO:0008287 protein serine/threonine phosphatase complex
cellular_component GO:0005737 cytoplasm
cellular_component GO:0005634 nucleus
cellular_component GO:0048046 apoplast
cellular_component GO:0016020 membrane
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0009506 plasmodesma
molecular_function GO:0003682 chromatin binding
molecular_function GO:0016762 xyloglucan:xyloglucosyl transferase activity
molecular_function GO:0004674 protein serine/threonine kinase activity
molecular_function GO:0004722 protein serine/threonine phosphatase activity
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0016740 transferase activity
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
molecular_function GO:0016874 ligase activity
molecular_function GO:0005515 protein binding
molecular_function GO:0004842 ubiquitin-protein transferase activity
molecular_function GO:0016301 kinase activity
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0005524 ATP binding
molecular_function GO:0004707 MAP kinase activity
molecular_function GO:0019899 enzyme binding
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
molecular_function GO:0030170 pyridoxal phosphate binding
molecular_function GO:0005179 hormone activity
molecular_function GO:0004871 obsolete signal transducer activity
molecular_function GO:0020037 heme binding
molecular_function GO:0005506 iron ion binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016847 1-aminocyclopropane-1-carboxylate synthase activity
molecular_function GO:0042802 identical protein binding
molecular_function GO:0003677 DNA binding
RNA-Seq Expression
   



Co-expression
Gener valueExpression
Spo260130.81Barchart | Table
Spo165870.78Barchart | Table
Spo201740.78Barchart | Table
Spo268990.77Barchart | Table
Spo002830.76Barchart | Table
Spo192170.76Barchart | Table
Spo057810.76Barchart | Table
Spo207290.75Barchart | Table
Spo001720.75Barchart | Table
Spo041290.75Barchart | Table
Spo077840.74Barchart | Table
Spo070770.74Barchart | Table
Spo238420.74Barchart | Table
Spo271650.74Barchart | Table
Spo142940.74Barchart | Table
Spo093330.74Barchart | Table
Spo013520.73Barchart | Table
Spo177130.73Barchart | Table
Spo007480.73Barchart | Table
Spo068850.73Barchart | Table
Spo215250.73Barchart | Table
Spo238430.73Barchart | Table
Spo240400.72Barchart | Table
Spo024540.72Barchart | Table
Spo031840.72Barchart | Table
Spo084190.72Barchart | Table
Spo158660.72Barchart | Table
Spo166480.72Barchart | Table
Spo249760.72Barchart | Table
Spo257870.72Barchart | Table
Spo243050.71Barchart | Table
Spo020910.71Barchart | Table
Spo271620.71Barchart | Table
Spo127120.71Barchart | Table
Spo198680.71Barchart | Table
Spo050460.71Barchart | Table
Spo142950.71Barchart | Table
Spo220330.71Barchart | Table
Spo093340.71Barchart | Table
Spo024810.71Barchart | Table
Spo134990.70Barchart | Table
Spo248180.70Barchart | Table
Spo074840.70Barchart | Table
Spo215090.70Barchart | Table
Spo025480.70Barchart | Table
Spo032030.70Barchart | Table
Spo198880.70Barchart | Table
Spo127190.70Barchart | Table
Spo237700.69Barchart | Table
Spo083250.69Barchart | Table
Spo121450.69Barchart | Table
Spo048720.69Barchart | Table
Spo177530.69Barchart | Table
Spo183830.69Barchart | Table
Spo216760.69Barchart | Table
Spo224360.69Barchart | Table
Spo238520.69Barchart | Table
Spo001900.69Barchart | Table
Spo007820.69Barchart | Table
Spo253500.68Barchart | Table
Spo111750.68Barchart | Table
Spo134820.68Barchart | Table
Spo016290.68Barchart | Table
Spo233820.68Barchart | Table
Spo096350.68Barchart | Table
Spo205620.68Barchart | Table
Spo107370.68Barchart | Table
Spo108260.68Barchart | Table
Spo006110.67Barchart | Table
Spo072150.67Barchart | Table
Spo184100.67Barchart | Table
Spo043790.67Barchart | Table
Spo097610.67Barchart | Table
Spo217850.67Barchart | Table
Spo054020.67Barchart | Table
Spo223960.67Barchart | Table
Spo060220.67Barchart | Table
Spo080340.67Barchart | Table
Spo058420.67Barchart | Table
Spo015140.67Barchart | Table
Spo054640.67Barchart | Table
Spo247690.67Barchart | Table
Spo125890.67Barchart | Table
Spo111930.67Barchart | Table
Spo132100.67Barchart | Table
Spo133830.67Barchart | Table
Spo135180.67Barchart | Table
Spo109100.66Barchart | Table
Spo104850.66Barchart | Table
Spo202920.66Barchart | Table
Spo050470.66Barchart | Table
Spo104440.66Barchart | Table
Spo147190.66Barchart | Table
Spo260860.66Barchart | Table
Spo076850.66Barchart | Table
Spo072360.66Barchart | Table
Spo146820.66Barchart | Table
Spo251290.66Barchart | Table
Spo270310.66Barchart | Table
Spo146670.65Barchart | Table
Spo173440.65Barchart | Table
Spo176310.65Barchart | Table
Spo168040.65Barchart | Table
Spo076460.65Barchart | Table
Spo238530.65Barchart | Table
Spo154990.65Barchart | Table
Spo063350.65Barchart | Table
Spo135830.65Barchart | Table
Spo111500.65Barchart | Table