

|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.TTTGGTGGAGGAACTTTAGGACACCCTTGGGGGAATGCACCAGGTGCTGTAGCAAACCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGACGTGATCTTGCTCGCGAAGGTAATACAATTATTCGCGAGGCTACCAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGATTTGGTGGAGGAACTTTAGGACACCCTTGGGGGAATGCACCAGGTGCTGTAGCAAACCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGACGTGATCTTGCTCGCGAAGGTAATACAATTATTCGCGAGGCTACCAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGA TTTGGTGGAGGAACTTTAGGACACCCTTGGGGGAATGCACCAGGTGCTGTAGCAAACCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAGGGACGTGATCTTGCTCGCGAAGGTAATACAATTATTCGCGAGGCTACCAAATGGAGTCCTGAACTAGCTGCTGCTTGTGAAGTATGA FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEV Relationships
The following mRNA feature(s) are a part of this gene:
Homology
BLAST of Spo01972.1 vs. NCBI nr
Match: gi|11497536|ref|NP_054944.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Spinacia oleracea]) HSP 1 Score: 126.3 bits (316), Expect = 1.800e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. NCBI nr
Match: gi|2392029|pdb|1AA1|L (Chain L, Activated Spinach Rubisco In Complex With The Product 3- Phosphoglycerate) HSP 1 Score: 126.3 bits (316), Expect = 1.800e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. NCBI nr
Match: gi|6689632|emb|CAB65533.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Melocarpum hildebrandtii]) HSP 1 Score: 126.3 bits (316), Expect = 1.800e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. NCBI nr
Match: gi|132051|sp|P00875.1|RBL_SPIOL (RecName: Full=Ribulose bisphosphate carboxylase large chain; Short=RuBisCO large subunit; Flags: Precursor) HSP 1 Score: 126.3 bits (316), Expect = 1.800e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. NCBI nr
Match: gi|1827835|pdb|8RUC|A (Chain A, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol Bisphosphate) HSP 1 Score: 126.3 bits (316), Expect = 1.800e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Match: Q6JXR3_9CARY (Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) OS=Blitum nuttallianum GN=rbcL PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.200e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Match: A0A0K9QPQ9_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_155340 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.200e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Match: Q9SBX7_9ROSI (Ribulose-bisphosphate carboxylase large subunit (Fragment) OS=Melocarpum hildebrandtii GN=rbcL PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.200e-26 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Match: A0A0M3SGK1_9CARY (Ribulose bisphosphate carboxylase large chain OS=Suaeda heterophylla GN=rbcL PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.600e-26 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Match: A0A0M5KJF6_SUAMA (Ribulose bisphosphate carboxylase large chain OS=Suaeda maritima GN=rbcL PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.600e-26 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Match: RBL_SPIOL (Ribulose bisphosphate carboxylase large chain OS=Spinacia oleracea GN=rbcL PE=1 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.100e-28 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Match: RBL_BULAR (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Bulnesia arborea GN=rbcL PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.200e-28 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Match: RBL_STEHA (Ribulose bisphosphate carboxylase large chain OS=Stegnosperma halimifolium GN=rbcL PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.200e-28 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Match: RBL_ATRPA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Atriplex patula GN=rbcL PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 4.200e-28 Identity = 58/60 (96.67%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Match: RBL_ATRRS (Ribulose bisphosphate carboxylase large chain OS=Atriplex rosea GN=rbcL PE=3 SV=2) HSP 1 Score: 124.4 bits (311), Expect = 4.200e-28 Identity = 58/60 (96.67%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Spo01972.1 vs. TAIR (Arabidopsis)
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases) HSP 1 Score: 118.6 bits (296), Expect = 1.300e-27 Identity = 57/60 (95.00%), Postives = 57/60 (95.00%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Spo01972.1 vs. NCBI nr
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. NCBI nr) Total hits: 5
BLAST of Spo01972.1 vs. UniProtKB/TrEMBL
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. UniprotKB/TrEMBL) Total hits: 5
BLAST of Spo01972.1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. ExPASy SwissProt) Total hits: 5
BLAST of Spo01972.1 vs. TAIR (Arabidopsis)
Analysis Date: 2018-06-29 (blastp Spinacia oleracea peptides vs. TAIR) Total hits: 1
InterPro
Analysis Name: InterPro Annotations of S. oleracea
Date Performed: 2018-06-29
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
RNA-Seq Expression
Co-expression
|